| Plus chapels, synagogues, mosques and temples, but the domain name would be too long.
Items are sorted in strict alphabetical order, not word by word, so that North Bridge is the same as Northbridge The source file gives elevations in meters and in feet, but why would anybody want elevations in feet when they can have a metric figure? |
|
Charlotte Church Sort code: CHARLOTTECHURCH0 Location: Randolph County, North Carolina, United States of America Feature ID: 1018010 Feature class: House of Worship Latitude: 35.7315255° North Longitude: 79.8680911° West Elevation: 183 meters above sea level |
|
Charlotte Friends Meeting Sort code: CHARLOTTEFRIENDSMEETING0 Location: Mecklenburg County, North Carolina, United States of America Feature ID: 1985686 Feature class: House of Worship Latitude: 35.2837534° North Longitude: 80.7520142° West Elevation: 211 meters above sea level |
|
Charlotte Gospel Hall Sort code: CHARLOTTEGOSPELHALL0 Location: Mecklenburg County, North Carolina, United States of America Feature ID: 983049 Feature class: House of Worship Latitude: 35.2298657° North Longitude: 80.7284025° West Elevation: 238 meters above sea level |
|
Charlotte Memorial Gardens Sort code: CHARLOTTEMEMORIALGARDENS0 Location: Mecklenburg County, North Carolina, United States of America Feature ID: 983050 Feature class: Cemetery Latitude: 35.2445806° North Longitude: 80.6897877° West Elevation: 211 meters above sea level |
|
Chatham Church Sort code: CHATHAMCHURCH0 Location: Alamance County, North Carolina, United States of America Feature ID: 983060 Feature class: House of Worship Latitude: 35.878196° North Longitude: 79.3097394° West Elevation: 164 meters above sea level |
|
Chatham Church Sort code: CHATHAMCHURCH0 Location: Chatham County, North Carolina, United States of America Feature ID: 983059 Feature class: House of Worship Latitude: 35.6498702° North Longitude: 79.2022395° West Elevation: 126 meters above sea level |
|
Chatham Memorial Park Sort code: CHATHAMMEMORIALPARK0 Location: Chatham County, North Carolina, United States of America Feature ID: 983061 Feature class: Cemetery Latitude: 35.7354186° North Longitude: 79.4108529° West Elevation: 169 meters above sea level |
|
Cheek and Whitaker Family Cemetery Sort code: CHEEKANDWHITAKERFAMILYCEMETERY0 Location: Orange County, North Carolina, United States of America Feature ID: 983066 Feature class: Cemetery Latitude: 35.9303035° North Longitude: 79.1212911° West Elevation: 170 meters above sea level |
|
Cheerful Hope Church Sort code: CHEERFULHOPECHURCH0 Location: Columbus County, North Carolina, United States of America Feature ID: 983067 Feature class: House of Worship Latitude: 34.2932242° North Longitude: 78.3197247° West Elevation: 16 meters above sea level |
|
Cheoah Church Sort code: CHEOAHCHURCH0 Location: Graham County, North Carolina, United States of America Feature ID: 1010191 Feature class: House of Worship Latitude: 35.3192551° North Longitude: 83.7982319° West Elevation: 647 meters above sea level |
|
Cherokee Church Sort code: CHEROKEECHURCH0 Location: Jackson County, North Carolina, United States of America Feature ID: 1010195 Feature class: House of Worship Latitude: 35.4667664° North Longitude: 83.2748719° West Elevation: 642 meters above sea level |
|
Cherokee Street Church Sort code: CHEROKEESTREETCHURCH0 Location: Cleveland County, North Carolina, United States of America Feature ID: 983071 Feature class: House of Worship Latitude: 35.2334674° North Longitude: 81.3453609° West Elevation: 292 meters above sea level |
|
Cherry Church of God Sort code: CHERRYCHURCHOFGOD0 Location: Washington County, North Carolina, United States of America Feature ID: 2505937 Feature class: House of Worship Latitude: 35.8453° North Longitude: 76.4201° West Elevation: 2 meters above sea level |
|
Cherry Church Sort code: CHERRYCHURCH0 Location: Halifax County, North Carolina, United States of America Feature ID: 983073 Feature class: House of Worship Latitude: 36.0173789° North Longitude: 77.4010794° West Elevation: 28 meters above sea level |
|
Cherry Grove Baptist Church Sort code: CHERRYGROVEBAPTISTCHURCH0 Location: Columbus County, North Carolina, United States of America Feature ID: 2505938 Feature class: House of Worship Latitude: 34.2401° North Longitude: 78.9672° West Elevation: 27 meters above sea level |
|
Cherry Grove Baptist Church Sort code: CHERRYGROVEBAPTISTCHURCH0 Location: Wilkes County, North Carolina, United States of America Feature ID: 983082 Feature class: House of Worship Latitude: 36.0823547° North Longitude: 81.0650798° West Elevation: 594 meters above sea level |
|
Cherry Grove Cemetery Sort code: CHERRYGROVECEMETERY0 Location: Columbus County, North Carolina, United States of America Feature ID: 983079 Feature class: Cemetery Latitude: 34.3031135° North Longitude: 78.7108265° West Elevation: 23 meters above sea level |
|
Cherry Grove Cemetery Sort code: CHERRYGROVECEMETERY0 Location: Wilkes County, North Carolina, United States of America Feature ID: 983080 Feature class: Cemetery Latitude: 36.0795698° North Longitude: 81.0675765° West Elevation: 604 meters above sea level |
|
Cherry Grove Church Sort code: CHERRYGROVECHURCH0 Location: Columbus County, North Carolina, United States of America Feature ID: 983081 Feature class: House of Worship Latitude: 34.2973911° North Longitude: 78.7100168° West Elevation: 24 meters above sea level |
|
Cherryhill Church Sort code: CHERRYHILLCHURCH0 Location: Davie County, North Carolina, United States of America Feature ID: 983092 Feature class: House of Worship Latitude: 35.7990276° North Longitude: 80.5008919° West Elevation: 239 meters above sea level |
|
Cherry Hill Church Sort code: CHERRYHILLCHURCH0 Location: Martin County, North Carolina, United States of America Feature ID: 1007478 Feature class: House of Worship Latitude: 35.9221017° North Longitude: 77.4235797° West Elevation: 24 meters above sea level |
|
Cherry Lane Cemetery Sort code: CHERRYLANECEMETERY0 Location: Alleghany County, North Carolina, United States of America Feature ID: 1959871 Feature class: Cemetery Latitude: 36.4398465° North Longitude: 81.0267431° West Elevation: 895 meters above sea level |
|
Cherry Lane Church Sort code: CHERRYLANECHURCH0 Location: Pitt County, North Carolina, United States of America Feature ID: 1024687 Feature class: House of Worship Latitude: 35.6440498° North Longitude: 77.269129° West Elevation: 8 meters above sea level |
|
Cherry Lane Free Will Baptist Church Sort code: CHERRYLANEFREEWILLBAPTISTCHURCH0 Location: Pitt County, North Carolina, United States of America Feature ID: 2505939 Feature class: House of Worship Latitude: 35.6033° North Longitude: 77.3911° West Elevation: 20 meters above sea level |
|
Cherry Lane Union Baptist Church Sort code: CHERRYLANEUNIONBAPTISTCHURCH0 Location: Alleghany County, North Carolina, United States of America Feature ID: 983085 Feature class: House of Worship Latitude: 36.4401314° North Longitude: 81.0267465° West Elevation: 895 meters above sea level |
|
Cherry Mountain Church Sort code: CHERRYMOUNTAINCHURCH0 Location: Rutherford County, North Carolina, United States of America Feature ID: 983086 Feature class: House of Worship Latitude: 35.3926242° North Longitude: 81.7900998° West Elevation: 327 meters above sea level |
|
Cherry Point Baptist Church Sort code: CHERRYPOINTBAPTISTCHURCH0 Location: Craven County, North Carolina, United States of America Feature ID: 2505940 Feature class: House of Worship Latitude: 34.8871° North Longitude: 76.9238° West Elevation: 7 meters above sea level |
|
Cherry Point Church of Christ Sort code: CHERRYPOINTCHURCHOFCHRIST0 Location: Craven County, North Carolina, United States of America Feature ID: 2505941 Feature class: House of Worship Latitude: 34.8813° North Longitude: 76.8904° West Elevation: 8 meters above sea level |
|
Cherry Run Church Sort code: CHERRYRUNCHURCH0 Location: Pitt County, North Carolina, United States of America Feature ID: 983089 Feature class: House of Worship Latitude: 35.5848845° North Longitude: 77.067731° West Elevation: 6 meters above sea level |
|
Cherrys Chapel Sort code: CHERRYSCHAPEL0 Location: Wilson County, North Carolina, United States of America Feature ID: 983093 Feature class: House of Worship Latitude: 35.814601° North Longitude: 77.7655334° West Elevation: 39 meters above sea level |
|
Cherry Springs Church Sort code: CHERRYSPRINGSCHURCH0 Location: McDowell County, North Carolina, United States of America Feature ID: 1023903 Feature class: House of Worship Latitude: 35.5823428° North Longitude: 82.1903909° West Elevation: 471 meters above sea level |
|
Cherryville City Memorial Cemetery Sort code: CHERRYVILLECITYMEMORIALCEMETERY0 Location: Gaston County, North Carolina, United States of America Feature ID: 2798408 Feature class: Cemetery Latitude: 35.3846176° North Longitude: 81.3771252° West Elevation: 290 meters above sea level |
|
Chestnut Church Sort code: CHESTNUTCHURCH0 Location: Lee County, North Carolina, United States of America Feature ID: 983098 Feature class: House of Worship Latitude: 35.5159879° North Longitude: 79.0241857° West Elevation: 115 meters above sea level |
|
Chestnut Church Sort code: CHESTNUTCHURCH0 Location: Richmond County, North Carolina, United States of America Feature ID: 983097 Feature class: House of Worship Latitude: 35.1268152° North Longitude: 80.0317242° West Elevation: 88 meters above sea level |
|
Chestnut Grove Baptist Church Cemetery Sort code: CHESTNUTGROVEBAPTISTCHURCHCEMETERY0 Location: Person County, North Carolina, United States of America Feature ID: 1966672 Feature class: Cemetery Latitude: 36.5292995° North Longitude: 79.111956° West Elevation: 183 meters above sea level |
|
Chestnut Grove Baptist Church Sort code: CHESTNUTGROVEBAPTISTCHURCH0 Location: Person County, North Carolina, United States of America Feature ID: 983108 Feature class: House of Worship Latitude: 36.5293067° North Longitude: 79.1125144° West Elevation: 183 meters above sea level |
|
Chestnut Grove Church Sort code: CHESTNUTGROVECHURCH0 Location: Alleghany County, North Carolina, United States of America Feature ID: 983107 Feature class: House of Worship Latitude: 36.504019° North Longitude: 81.073694° West Elevation: 889 meters above sea level |
|
Chestnut Grove Church Sort code: CHESTNUTGROVECHURCH0 Location: Buncombe County, North Carolina, United States of America Feature ID: 1010250 Feature class: House of Worship Latitude: 35.6701041° North Longitude: 82.8379152° West Elevation: 741 meters above sea level |
|
Chestnut Grove Church Sort code: CHESTNUTGROVECHURCH0 Location: Davie County, North Carolina, United States of America Feature ID: 983104 Feature class: House of Worship Latitude: 35.9598585° North Longitude: 80.6142286° West Elevation: 271 meters above sea level |
|
Chestnut Grove Church Sort code: CHESTNUTGROVECHURCH0 Location: Halifax County, North Carolina, United States of America Feature ID: 983105 Feature class: House of Worship Latitude: 36.2234884° North Longitude: 77.4463601° West Elevation: 19 meters above sea level |
|
Chestnut Grove Church Sort code: CHESTNUTGROVECHURCH0 Location: Iredell County, North Carolina, United States of America Feature ID: 983102 Feature class: House of Worship Latitude: 35.8587486° North Longitude: 80.7672912° West Elevation: 252 meters above sea level |
|
Chestnut Grove Church Sort code: CHESTNUTGROVECHURCH0 Location: Mitchell County, North Carolina, United States of America Feature ID: 1010251 Feature class: House of Worship Latitude: 35.8573436° North Longitude: 82.1020613° West Elevation: 1095 meters above sea level |
|
Chestnut Grove Church Sort code: CHESTNUTGROVECHURCH0 Location: Wake County, North Carolina, United States of America Feature ID: 983103 Feature class: House of Worship Latitude: 35.958759° North Longitude: 78.7044486° West Elevation: 126 meters above sea level |
|
Chestnut Grove Church Sort code: CHESTNUTGROVECHURCH0 Location: Wilkes County, North Carolina, United States of America Feature ID: 983106 Feature class: House of Worship Latitude: 36.2762418° North Longitude: 81.2417569° West Elevation: 610 meters above sea level |
|
Chestnut Grove United Methodist Church Sort code: CHESTNUTGROVEUNITEDMETHODISTCHURCH0 Location: Stokes County, North Carolina, United States of America Feature ID: 1952657 Feature class: House of Worship Latitude: 36.3231939° North Longitude: 80.3850545° West Elevation: 312 meters above sea level |
|
Chestnut Hill Cemetery Sort code: CHESTNUTHILLCEMETERY0 Location: Rowan County, North Carolina, United States of America Feature ID: 983109 Feature class: Cemetery Latitude: 35.659236° North Longitude: 80.4846837° West Elevation: 231 meters above sea level |
|
Chestnut Hill Church Sort code: CHESTNUTHILLCHURCH0 Location: Ashe County, North Carolina, United States of America Feature ID: 983110 Feature class: House of Worship Latitude: 36.5051256° North Longitude: 81.343987° West Elevation: 849 meters above sea level |
|
Chestnut Hill Church Sort code: CHESTNUTHILLCHURCH0 Location: Madison County, North Carolina, United States of America Feature ID: 1010252 Feature class: House of Worship Latitude: 35.9053836° North Longitude: 82.6768054° West Elevation: 661 meters above sea level |
|
Chestnut Ridge Church Sort code: CHESTNUTRIDGECHURCH0 Location: Gaston County, North Carolina, United States of America Feature ID: 983129 Feature class: House of Worship Latitude: 35.2848563° North Longitude: 81.3409166° West Elevation: 295 meters above sea level |
|
Chestnut Ridge Church Sort code: CHESTNUTRIDGECHURCH0 Location: Orange County, North Carolina, United States of America Feature ID: 983130 Feature class: House of Worship Latitude: 36.0368064° North Longitude: 79.1889037° West Elevation: 234 meters above sea level |
|
Chestnut Ridge Church Sort code: CHESTNUTRIDGECHURCH0 Location: Surry County, North Carolina, United States of America Feature ID: 983131 Feature class: House of Worship Latitude: 36.5109694° North Longitude: 80.5058939° West Elevation: 486 meters above sea level |
|
Chimney Rock Baptist Church Sort code: CHIMNEYROCKBAPTISTCHURCH0 Location: Rutherford County, North Carolina, United States of America Feature ID: 1008422 Feature class: House of Worship Latitude: 35.4378968° North Longitude: 82.2306683° West Elevation: 311 meters above sea level |
|
China Grove Cemetery Sort code: CHINAGROVECEMETERY0 Location: Rowan County, North Carolina, United States of America Feature ID: 983140 Feature class: Cemetery Latitude: 35.587258° North Longitude: 80.5575072° West Elevation: 248 meters above sea level |
|
China Grove Church Sort code: CHINAGROVECHURCH0 Location: Columbus County, North Carolina, United States of America Feature ID: 983141 Feature class: House of Worship Latitude: 34.2804462° North Longitude: 78.8597455° West Elevation: 31 meters above sea level |
|
China Grove Church Sort code: CHINAGROVECHURCH0 Location: Cumberland County, North Carolina, United States of America Feature ID: 983142 Feature class: House of Worship Latitude: 34.8554468° North Longitude: 78.6383472° West Elevation: 35 meters above sea level |
|
China Grove Church Sort code: CHINAGROVECHURCH0 Location: Cumberland County, North Carolina, United States of America Feature ID: 983143 Feature class: House of Worship Latitude: 35.0201665° North Longitude: 78.6908505° West Elevation: 38 meters above sea level |
|
China Grove Church Sort code: CHINAGROVECHURCH0 Location: Mecklenburg County, North Carolina, United States of America Feature ID: 983144 Feature class: House of Worship Latitude: 35.1095896° North Longitude: 80.8853509° West Elevation: 203 meters above sea level |
|
Chinese Baptist Church Sort code: CHINESEBAPTISTCHURCH0 Location: Wake County, North Carolina, United States of America Feature ID: 2454293 Feature class: House of Worship Latitude: 35.792604° North Longitude: 78.675898° West Elevation: 132 meters above sea level |
|
Chinnis Cemetery Sort code: CHINNISCEMETERY0 Location: Brunswick County, North Carolina, United States of America Feature ID: 983146 Feature class: Cemetery Latitude: 34.2728908° North Longitude: 78.1345916° West Elevation: 12 meters above sea level |
|
Chinquapin Cemetery Sort code: CHINQUAPINCEMETERY0 Location: Yadkin County, North Carolina, United States of America Feature ID: 1731722 Feature class: Cemetery Latitude: 36.0498511° North Longitude: 80.6197809° West Elevation: 263 meters above sea level |
|
Chinquapin Chapel Sort code: CHINQUAPINCHAPEL0 Location: Jones County, North Carolina, United States of America Feature ID: 1003931 Feature class: House of Worship Latitude: 35.0832172° North Longitude: 77.4524629° West Elevation: 14 meters above sea level |
|
Chinquapin Church Sort code: CHINQUAPINCHURCH0 Location: Yadkin County, North Carolina, United States of America Feature ID: 983150 Feature class: House of Worship Latitude: 36.0495804° North Longitude: 80.6192285° West Elevation: 264 meters above sea level |
|
Chisolm Cemetery Sort code: CHISOLMCEMETERY0 Location: Montgomery County, North Carolina, United States of America Feature ID: 1008275 Feature class: Cemetery Latitude: 35.2853867° North Longitude: 79.9101664° West Elevation: 130 meters above sea level |
|
Chockoyotte Church Sort code: CHOCKOYOTTECHURCH0 Location: Halifax County, North Carolina, United States of America Feature ID: 983158 Feature class: House of Worship Latitude: 36.43154° North Longitude: 77.6349786° West Elevation: 40 meters above sea level |
|
Christ Baptist Church Sort code: CHRISTBAPTISTCHURCH0 Location: Wake County, North Carolina, United States of America Feature ID: 2454294 Feature class: House of Worship Latitude: 35.8781094° North Longitude: 78.6442155° West Elevation: 99 meters above sea level |
|
Christ Cathedral Oasis of Love Church Sort code: CHRISTCATHEDRALOASISOFLOVECHURCH0 Location: Durham County, North Carolina, United States of America Feature ID: 2454295 Feature class: House of Worship Latitude: 36.0304581° North Longitude: 78.9357608° West Elevation: 127 meters above sea level |
|
Christ Church Sort code: CHRISTCHURCH0 Location: Alamance County, North Carolina, United States of America Feature ID: 983165 Feature class: House of Worship Latitude: 36.0348594° North Longitude: 79.3922418° West Elevation: 174 meters above sea level |
|
Christ Church Sort code: CHRISTCHURCH0 Location: Iredell County, North Carolina, United States of America Feature ID: 983164 Feature class: House of Worship Latitude: 35.7920814° North Longitude: 80.849239° West Elevation: 264 meters above sea level |
|
Christ Church Sort code: CHRISTCHURCH0 Location: Wilkes County, North Carolina, United States of America Feature ID: 983166 Feature class: House of Worship Latitude: 36.1084657° North Longitude: 81.0798028° West Elevation: 442 meters above sea level |
|
Christ Community Church Sort code: CHRISTCOMMUNITYCHURCH0 Location: New Hanover County, North Carolina, United States of America Feature ID: 2505847 Feature class: House of Worship Latitude: 34.1654° North Longitude: 77.8628° West Elevation: 6 meters above sea level |
|
Christ Covenant Church Sort code: CHRISTCOVENANTCHURCH0 Location: Wake County, North Carolina, United States of America Feature ID: 2454296 Feature class: House of Worship Latitude: 35.867779° North Longitude: 78.5623078° West Elevation: 93 meters above sea level |
|
Christ Episcopal Church Memorial Garden Sort code: CHRISTEPISCOPALCHURCHMEMORIALGARDEN0 Location: Pasquotank County, North Carolina, United States of America Feature ID: 2798352 Feature class: Cemetery Latitude: 36.2961808° North Longitude: 76.2202424° West Elevation: 2 meters above sea level |
|
Christ Episcopal Church Sort code: CHRISTEPISCOPALCHURCH0 Location: Craven County, North Carolina, United States of America Feature ID: 1018676 Feature class: House of Worship Latitude: 35.1076598° North Longitude: 77.0457811° West Elevation: 5 meters above sea level |
|
Christ Episcopal Church Sort code: CHRISTEPISCOPALCHURCH0 Location: Pasquotank County, North Carolina, United States of America Feature ID: 1003188 Feature class: House of Worship Latitude: 36.2987677° North Longitude: 76.2204892° West Elevation: 2 meters above sea level |
|
Christ Episcopal Church Sort code: CHRISTEPISCOPALCHURCH0 Location: Wake County, North Carolina, United States of America Feature ID: 2454297 Feature class: House of Worship Latitude: 35.780882° North Longitude: 78.6374462° West Elevation: 106 meters above sea level |
|
Christ Fellowship Church Sort code: CHRISTFELLOWSHIPCHURCH0 Location: Moore County, North Carolina, United States of America Feature ID: 2740664 Feature class: House of Worship Latitude: 35.1973256° North Longitude: 79.4021469° West Elevation: 154 meters above sea level |
|
Christiana Cemetery Sort code: CHRISTIANACEMETERY0 Location: Rowan County, North Carolina, United States of America Feature ID: 983178 Feature class: Cemetery Latitude: 35.5974051° North Longitude: 80.4267318° West Elevation: 242 meters above sea level |
|
Christian Aid Society Cemetery Sort code: CHRISTIANAIDSOCIETYCEMETERY0 Location: Mecklenburg County, North Carolina, United States of America Feature ID: 2778912 Feature class: Cemetery Latitude: 35.5025596° North Longitude: 80.8379233° West Elevation: 242 meters above sea level |
|
Christian and Missionary Alliance Community Church Sort code: CHRISTIANANDMISSIONARYALLIANCECOMMUNITYCHURCH0 Location: Durham County, North Carolina, United States of America Feature ID: 2454300 Feature class: House of Worship Latitude: 36.0021906° North Longitude: 78.9084291° West Elevation: 115 meters above sea level |
|
Christian Assembly Church Sort code: CHRISTIANASSEMBLYCHURCH0 Location: Durham County, North Carolina, United States of America Feature ID: 2454301 Feature class: House of Worship Latitude: 36.092788° North Longitude: 78.9098822° West Elevation: 140 meters above sea level |
|
Christian Chapel Sort code: CHRISTIANCHAPEL0 Location: Brunswick County, North Carolina, United States of America Feature ID: 983169 Feature class: House of Worship Latitude: 34.1196154° North Longitude: 78.1083272° West Elevation: 10 meters above sea level |
|
Christian Chapel Sort code: CHRISTIANCHAPEL0 Location: Chatham County, North Carolina, United States of America Feature ID: 1951039 Feature class: House of Worship Latitude: 35.6007089° North Longitude: 78.9886265° West Elevation: 83 meters above sea level |
|
Christian Chapel Sort code: CHRISTIANCHAPEL0 Location: Wake County, North Carolina, United States of America Feature ID: 983170 Feature class: House of Worship Latitude: 35.7043187° North Longitude: 78.9152878° West Elevation: 108 meters above sea level |
|
Christian Church Sort code: CHRISTIANCHURCH0 Location: Mitchell County, North Carolina, United States of America Feature ID: 1018021 Feature class: House of Worship Latitude: 36.045945° North Longitude: 82.2979089° West Elevation: 649 meters above sea level |
|
Christian Corps International Sort code: CHRISTIANCORPSINTERNATIONAL0 Location: Wake County, North Carolina, United States of America Feature ID: 2454302 Feature class: House of Worship Latitude: 35.8681331° North Longitude: 78.6382089° West Elevation: 128 meters above sea level |
|
Christian Creek Church Sort code: CHRISTIANCREEKCHURCH0 Location: Buncombe County, North Carolina, United States of America Feature ID: 983172 Feature class: House of Worship Latitude: 35.5962259° North Longitude: 82.4362331° West Elevation: 690 meters above sea level |
|
Christian Faith Baptist Church Sort code: CHRISTIANFAITHBAPTISTCHURCH0 Location: Wake County, North Carolina, United States of America Feature ID: 2454303 Feature class: House of Worship Latitude: 35.7413939° North Longitude: 78.6328514° West Elevation: 108 meters above sea level |
|
Christian Harbor Church Sort code: CHRISTIANHARBORCHURCH0 Location: Hertford County, North Carolina, United States of America Feature ID: 1000857 Feature class: House of Worship Latitude: 36.2637671° North Longitude: 76.7413396° West Elevation: 20 meters above sea level |
|
Christian Home Baptist Church Cemetery Sort code: CHRISTIANHOMEBAPTISTCHURCHCEMETERY0 Location: Currituck County, North Carolina, United States of America Feature ID: 2798310 Feature class: Cemetery Latitude: 36.5217899° North Longitude: 76.1688824° West Elevation: 2 meters above sea level |
|
Christian Home Church Sort code: CHRISTIANHOMECHURCH0 Location: Wilkes County, North Carolina, United States of America Feature ID: 983174 Feature class: House of Worship Latitude: 36.2970767° North Longitude: 81.0581361° West Elevation: 390 meters above sea level |
|
Christian Hope Church Sort code: CHRISTIANHOPECHURCH0 Location: Brunswick County, North Carolina, United States of America Feature ID: 983175 Feature class: House of Worship Latitude: 34.2371138° North Longitude: 78.1419403° West Elevation: 18 meters above sea level |
|
Christian Hope Church Sort code: CHRISTIANHOPECHURCH0 Location: Washington County, North Carolina, United States of America Feature ID: 983176 Feature class: House of Worship Latitude: 35.747384° North Longitude: 76.8077227° West Elevation: 12 meters above sea level |
|
Christian Life Fellowship Church Sort code: CHRISTIANLIFEFELLOWSHIPCHURCH0 Location: Onslow County, North Carolina, United States of America Feature ID: 2505848 Feature class: House of Worship Latitude: 34.8165° North Longitude: 77.456° West Elevation: 10 meters above sea level |
|
Christian Light Church Sort code: CHRISTIANLIGHTCHURCH0 Location: Cumberland County, North Carolina, United States of America Feature ID: 1004265 Feature class: House of Worship Latitude: 34.9762786° North Longitude: 78.6586263° West Elevation: 38 meters above sea level |
|
Christian Missionary Faith Church Sort code: CHRISTIANMISSIONARYFAITHCHURCH0 Location: Wake County, North Carolina, United States of America Feature ID: 2454304 Feature class: House of Worship Latitude: 35.8681331° North Longitude: 78.6382089° West Elevation: 128 meters above sea level |
|
Christian Plain Church Sort code: CHRISTIANPLAINCHURCH0 Location: Columbus County, North Carolina, United States of America Feature ID: 1004365 Feature class: House of Worship Latitude: 34.4362809° North Longitude: 78.6269578° West Elevation: 31 meters above sea level |
|
Christian Tabernacle Sort code: CHRISTIANTABERNACLE0 Location: Cleveland County, North Carolina, United States of America Feature ID: 1003891 Feature class: House of Worship Latitude: 35.2576277° North Longitude: 81.5737034° West Elevation: 230 meters above sea level |
|
Christian Tabernacle Sort code: CHRISTIANTABERNACLE0 Location: Durham County, North Carolina, United States of America Feature ID: 2454305 Feature class: House of Worship Latitude: 35.994316° North Longitude: 78.8794046° West Elevation: 112 meters above sea level |
|
Christian View Cemetery Sort code: CHRISTIANVIEWCEMETERY0 Location: Rockingham County, North Carolina, United States of America Feature ID: 1953148 Feature class: Cemetery Latitude: 36.5394033° North Longitude: 79.9410898° West Elevation: 306 meters above sea level |
|
Christian View Pentecostal Holiness Church Sort code: CHRISTIANVIEWPENTECOSTALHOLINESSCHURCH0 Location: Rockingham County, North Carolina, United States of America Feature ID: 983177 Feature class: House of Worship Latitude: 36.5390271° North Longitude: 79.9403196° West Elevation: 306 meters above sea level |