| Plus chapels, synagogues, mosques and temples, but the domain name would be too long.
HOME PAGE Items are sorted in strict alphabetical order, not word by word, so that North Bridge is the same as Northbridge The source file gives elevations in meters and in feet, but why would anybody want elevations in feet when they can have a metric figure? |
|
Bethany Baptist Church
Sort code: BETHANYBAPTISTCHURCH0 Location: Trego County, Kansas, United States of America Feature ID: 2690991 Feature class: House of Worship Latitude: 39.0196603° North Longitude: 99.882033° West Elevation: 746 meters above sea level |
|
Bethlehem Lutheran Church
Sort code: BETHLEHEMLUTHERANCHURCH0 Location: Trego County, Kansas, United States of America Feature ID: 2690992 Feature class: House of Worship Latitude: 39.0283125° North Longitude: 99.8806315° West Elevation: 750 meters above sea level |
|
Christ the King Catholic Cemetery
Sort code: CHRISTTHEKINGCATHOLICCEMETERY0 Location: Trego County, Kansas, United States of America Feature ID: 1958268 Feature class: Cemetery Latitude: 39.016662° North Longitude: 99.870441° West Elevation: 748 meters above sea level |
|
Christ the King Catholic Church
Sort code: CHRISTTHEKINGCATHOLICCHURCH0 Location: Trego County, Kansas, United States of America Feature ID: 1958269 Feature class: House of Worship Latitude: 39.0289099° North Longitude: 99.8774194° West Elevation: 749 meters above sea level |
|
Emanuel Lutheran Cemetery
Sort code: EMANUELLUTHERANCEMETERY0 Location: Trego County, Kansas, United States of America Feature ID: 1958267 Feature class: Cemetery Latitude: 38.8805666° North Longitude: 99.7442845° West Elevation: 731 meters above sea level |
|
Emanuel Lutheran Church
Sort code: EMANUELLUTHERANCHURCH0 Location: Trego County, Kansas, United States of America Feature ID: 475170 Feature class: House of Worship Latitude: 38.8803763° North Longitude: 99.7437181° West Elevation: 731 meters above sea level |
|
Harvestime Assembly of God Church
Sort code: HARVESTIMEASSEMBLYOFGODCHURCH0 Location: Trego County, Kansas, United States of America Feature ID: 2690993 Feature class: House of Worship Latitude: 39.0266455° North Longitude: 99.8853385° West Elevation: 752 meters above sea level |
|
Immanuel Lutheran Church
Sort code: IMMANUELLUTHERANCHURCH0 Location: Trego County, Kansas, United States of America Feature ID: 2690994 Feature class: House of Worship Latitude: 39.029933° North Longitude: 99.8836708° West Elevation: 750 meters above sea level |
|
Kansas Veterans' Cemetery at Wakeeney
Sort code: KANSASVETERANSCEMETERYATWAKEENEY0 Location: Trego County, Kansas, United States of America Feature ID: 2770058 Feature class: Cemetery Latitude: 39.0181773° North Longitude: 99.8734286° West Elevation: 741 meters above sea level |
|
Ogallah Cemetery
Sort code: OGALLAHCEMETERY0 Location: Trego County, Kansas, United States of America Feature ID: 475169 Feature class: Cemetery Latitude: 38.9926013° North Longitude: 99.7242982° West Elevation: 719 meters above sea level |
|
Ogallah Christian Church
Sort code: OGALLAHCHRISTIANCHURCH0 Location: Trego County, Kansas, United States of America Feature ID: 1958270 Feature class: House of Worship Latitude: 38.9898685° North Longitude: 99.7332564° West Elevation: 723 meters above sea level |
|
Saint Michael Catholic Church
Sort code: SAINTMICHAELCATHOLICCHURCH0 Location: Trego County, Kansas, United States of America Feature ID: 471357 Feature class: House of Worship Latitude: 39.0313965° North Longitude: 100.1170732° West Elevation: 790 meters above sea level |
|
Saint Michael's Cemetery
Sort code: SAINTMICHAELSCEMETERY0 Location: Trego County, Kansas, United States of America Feature ID: 471358 Feature class: Cemetery Latitude: 39.0315804° North Longitude: 100.1153651° West Elevation: 788 meters above sea level |
|
Saline Valley Cemetery
Sort code: SALINEVALLEYCEMETERY0 Location: Trego County, Kansas, United States of America Feature ID: 472514 Feature class: Cemetery Latitude: 39.117672° North Longitude: 99.961625° West Elevation: 708 meters above sea level |
|
Union Cemetery
Sort code: UNIONCEMETERY0 Location: Trego County, Kansas, United States of America Feature ID: 1958272 Feature class: Cemetery Elevation: meters above sea level |
|
Union Cemetery
Sort code: UNIONCEMETERY0 Location: Trego County, Kansas, United States of America Feature ID: 471359 Feature class: Cemetery Latitude: 39.0301274° North Longitude: 100.1123871° West Elevation: 788 meters above sea level |
|
WaKeeney Church of God
Sort code: WAKEENEYCHURCHOFGOD0 Location: Trego County, Kansas, United States of America Feature ID: 2690995 Feature class: House of Worship Latitude: 39.0290075° North Longitude: 99.8713191° West Elevation: 750 meters above sea level |
|
Wakeeney City Cemetery
Sort code: WAKEENEYCITYCEMETERY0 Location: Trego County, Kansas, United States of America Feature ID: 472516 Feature class: Cemetery Latitude: 39.016215° North Longitude: 99.873733° West Elevation: 745 meters above sea level |
|
WaKeeney Presbyterian Church
Sort code: WAKEENEYPRESBYTERIANCHURCH0 Location: Trego County, Kansas, United States of America Feature ID: 2690996 Feature class: House of Worship Latitude: 39.0282831° North Longitude: 99.8821396° West Elevation: 750 meters above sea level |
|
WaKeeney United Methodist Church
Sort code: WAKEENEYUNITEDMETHODISTCHURCH0 Location: Trego County, Kansas, United States of America Feature ID: 2689562 Feature class: House of Worship Latitude: 39.0365476° North Longitude: 99.8842128° West Elevation: 749 meters above sea level |
|
Zion Lutheran Cemetery
Sort code: ZIONLUTHERANCEMETERY0 Location: Trego County, Kansas, United States of America Feature ID: 475165 Feature class: Cemetery Latitude: 38.8781291° North Longitude: 99.8927372° West Elevation: 721 meters above sea level |
|
Zion Lutheran Church
Sort code: ZIONLUTHERANCHURCH0 Location: Trego County, Kansas, United States of America Feature ID: 2690997 Feature class: House of Worship Latitude: 38.8847075° North Longitude: 99.892269° West Elevation: 726 meters above sea level |